| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acyl-protein thioesterase 2 |
|---|
| Ligand | BDBM92717 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzymatic Protein Activity Assay |
|---|
| IC50 | 1.97e+3± 1.0e+2 nM |
|---|
| Citation |  Zimmermann, TJ; Bürger, M; Tashiro, E; Kondoh, Y; Martinez, NE; Görmer, K; Rosin-Steiner, S; Shimizu, T; Ozaki, S; Mikoshiba, K; Watanabe, N; Hall, D; Vetter, IR; Osada, H; Hedberg, C; Waldmann, H Boron-based inhibitors of acyl protein thioesterases 1 and 2. Chembiochem14:115-22 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acyl-protein thioesterase 2 |
|---|
| Name: | Acyl-protein thioesterase 2 |
|---|
| Synonyms: | APT2 | Acyl-protein thioesterase 2 (APT2 WT) | LYPA2_HUMAN | LYPLA2 | Lysophospholipase II |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24740.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O95372 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
|
|
|
|---|
| BDBM92717 |
|---|
| n/a |
|---|
| Name | BDBM92717 |
|---|
| Synonyms: | Phenylboronic acid, 8 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C6H5BF2O2 |
|---|
| Mol. Mass. | 157.911 |
|---|
| SMILES | OB(O)c1cc(F)cc(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
