Reaction Details |
| Report a problem with these data |
Target | Acyl-protein thioesterase 2 |
---|
Ligand | BDBM26140 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzymatic Protein Activity Assay |
---|
IC50 | 1.13e+4± 4.0e+3 nM |
---|
Citation | Zimmermann, TJ; Bürger, M; Tashiro, E; Kondoh, Y; Martinez, NE; Görmer, K; Rosin-Steiner, S; Shimizu, T; Ozaki, S; Mikoshiba, K; Watanabe, N; Hall, D; Vetter, IR; Osada, H; Hedberg, C; Waldmann, H Boron-based inhibitors of acyl protein thioesterases 1 and 2. Chembiochem14:115-22 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Acyl-protein thioesterase 2 |
---|
Name: | Acyl-protein thioesterase 2 |
Synonyms: | APT2 | Acyl-protein thioesterase 2 (APT2 WT) | LYPA2_HUMAN | LYPLA2 | Lysophospholipase II |
Type: | Protein |
Mol. Mass.: | 24740.23 |
Organism: | Homo sapiens (Human) |
Description: | O95372 |
Residue: | 231 |
Sequence: | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
|
|
|
BDBM26140 |
---|
n/a |
---|
Name | BDBM26140 |
Synonyms: | 1-benzofuran-2-ylboranediol | 1-benzofuran-2-ylboronic acid, 19 | CHEMBL143399 | Phenylboronic acid, 21 |
Type | Small organic molecule |
Emp. Form. | C8H7BO3 |
Mol. Mass. | 161.95 |
SMILES | OB(O)c1cc2ccccc2o1 |
Structure |
|