Reaction Details |
| Report a problem with these data |
Target | Isochorismatase family protein |
---|
Ligand | BDBM92851 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | GDH-Coupled Nicotinamidase Assay |
---|
Ki | 140±20 nM |
---|
Citation | French, JB; Cen, Y; Vrablik, TL; Xu, P; Allen, E; Hanna-Rose, W; Sauve, AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry49:10421-39 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isochorismatase family protein |
---|
Name: | Isochorismatase family protein |
Synonyms: | Nicotinamidase (SpNic) | Pyrazinamidase/nicotinamidase |
Type: | Enzyme |
Mol. Mass.: | 21361.69 |
Organism: | Streptococcus pneumoniae |
Description: | A0A098ZGI7 |
Residue: | 191 |
Sequence: | MTKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDC
FHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRE
RRVSTVILTGVLTDICVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAK
LVDENLNELSE
|
|
|
BDBM92851 |
---|
n/a |
---|
Name | BDBM92851 |
Synonyms: | Nicotinamidase Inhibitor, 18 |
Type | Small molecule |
Emp. Form. | C7H7NO2 |
Mol. Mass. | 137.136 |
SMILES | COc1cncc(C=O)c1 |
Structure |
|