Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinamidase (SpNic)
LigandBDBM92853
Substrate/Competitorn/a
Meas. Tech.GDH-Coupled Nicotinamidase Assay
Ki 110000±0 nM
Citation French JBCen YVrablik TLXu PAllen EHanna-Rose WSauve AA Characterization of nicotinamidases: steady state kinetic parameters, classwide inhibition by nicotinaldehydes, and catalytic mechanism. Biochemistry 49:10421-39 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinamidase (SpNic)
Name:Nicotinamidase (SpNic)
Synonyms:Pyrazinamidase/nicotinamidase
Type:Enzyme
Mol. Mass.:21361.69
Organism:Streptococcus pneumoniae
Description:A0A098ZGI7
Residue:191
Sequence:
MTKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDC
FHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRE
RRVSTVILTGVLTDICVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAK
LVDENLNELSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92853
n/a
NameBDBM92853
Synonyms:Nicotinamidase Inhibitor, 20
TypeSmall molecule
Emp. Form.C6H4ClNO
Mol. Mass.141.555
SMILESClc1ncccc1C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: