| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glucose-1-phosphate thymidylyltransferase |
|---|
| Ligand | BDBM93080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 2.1e+2± 3e+1 nM |
|---|
| Citation |  Alphey, MS; Pirrie, L; Torrie, LS; Boulkeroua, WA; Gardiner, M; Sarkar, A; Maringer, M; Oehlmann, W; Brenk, R; Scherman, MS; McNeil, M; Rejzek, M; Field, RA; Singh, M; Gray, D; Westwood, NJ; Naismith, JH Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa. ACS Chem Biol8:387-96 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glucose-1-phosphate thymidylyltransferase |
|---|
| Name: | Glucose-1-phosphate thymidylyltransferase |
|---|
| Synonyms: | Glucose-1-phosphate thymidylyltransferase (RmlA) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 32451.00 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | Q9HU22 |
|---|
| Residue: | 293 |
|---|
| Sequence: | MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDT
PRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHE
LLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQ
QVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA
TLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
|
|
|
|---|
| BDBM93080 |
|---|
| n/a |
|---|
| Name | BDBM93080 |
|---|
| Synonyms: | Analogue of 1a, 1 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C15H20N4O4S |
|---|
| Mol. Mass. | 352.409 |
|---|
| SMILES | CCCCn1c(N)c(N(C)S(=O)(=O)c2ccccc2)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
