| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM39886 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 6650±576 nM |
|---|
| Citation |  PubChem, PC Dose-response confirmation of uHTS inhibitor hits of Sentrin-Specific Protease 8 using a kinetic assay with Nedd8 Protein Substrate PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM39886 |
|---|
| n/a |
|---|
| Name | BDBM39886 |
|---|
| Synonyms: | 4b,9b-bis(oxidanyl)-7,8-dihydro-6H-indeno[1,2-b][1]benzofuran-9,10-dione | 4b,9b-dihydroxy-7,8-dihydro-6H-indeno[1,2-b][1]benzofuran-9,10-dione | 4b,9b-dihydroxy-7,8-dihydro-6H-indeno[1,2-b]benzofuran-9,10-dione | 4b,9b-dihydroxy-7,8-dihydro-6H-indeno[1,2-b]benzofuran-9,10-quinone | MLS000104338 | SMR000054273 | cid_2834991 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12O5 |
|---|
| Mol. Mass. | 272.2528 |
|---|
| SMILES | OC12OC3=C(C(=O)CCC3)C1(O)C(=O)c1ccccc21 |t:3| |
|---|
| Structure | 
|
|---|
Search and Browse
