| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM93616 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 12500±1590 nM |
|---|
| Citation |  PubChem, PC Dose-response confirmation of uHTS inhibitor hits of Sentrin-Specific Protease 8 using a kinetic assay with Nedd8 Protein Substrate PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM93616 |
|---|
| n/a |
|---|
| Name | BDBM93616 |
|---|
| Synonyms: | 1-[4-[[1-[2-(4-hydroxyphenyl)-2-keto-ethyl]triazol-4-yl]methoxy]phenyl]propan-1-one | 1-[4-[[1-[2-(4-hydroxyphenyl)-2-oxidanylidene-ethyl]-1,2,3-triazol-4-yl]methoxy]phenyl]propan-1-one | 1-[4-[[1-[2-(4-hydroxyphenyl)-2-oxoethyl]-4-triazolyl]methoxy]phenyl]-1-propanone | 1-[4-[[1-[2-(4-hydroxyphenyl)-2-oxoethyl]triazol-4-yl]methoxy]phenyl]propan-1-one | KUC104108 | MLS002768355 | SMR001788364 | cid_45480030 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19N3O4 |
|---|
| Mol. Mass. | 365.3826 |
|---|
| SMILES | CCC(=O)c1ccc(OCc2cn(CC(=O)c3ccc(O)cc3)nn2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
