| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM88790 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 15350±n/a nM |
|---|
| Citation |  PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, via a fluorescence intensity assay PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM88790 |
|---|
| n/a |
|---|
| Name | BDBM88790 |
|---|
| Synonyms: | 4-[({[(2E)-3-(4-chlorophenyl)prop-2-enoyl]amino}carbonothioyl)amino]benzoic acid | 4-[[(E)-3-(4-chlorophenyl)acryloyl]thiocarbamoylamino]benzoic acid | 4-[[(E)-3-(4-chlorophenyl)prop-2-enoyl]carbamothioylamino]benzoic acid | 4-[[[[(E)-3-(4-chlorophenyl)-1-oxoprop-2-enyl]amino]-sulfanylidenemethyl]amino]benzoic acid | MLS001196128 | SMR000558511 | cid_1329095 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13ClN2O3S |
|---|
| Mol. Mass. | 360.815 |
|---|
| SMILES | OC(=O)c1ccc(NC(=S)NC(=O)C=Cc2ccc(Cl)cc2)cc1 |w:14.14| |
|---|
| Structure | 
|
|---|
Search and Browse
