Reaction Details |
| Report a problem with these data |
Target | Low molecular weight phosphotyrosine protein phosphatase |
---|
Ligand | BDBM94981 |
---|
Substrate/Competitor | n/a |
---|
IC50 | 2590±n/a nM |
---|
Citation | PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, via a fluorescence intensity assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article |
---|
|
Low molecular weight phosphotyrosine protein phosphatase |
---|
Name: | Low molecular weight phosphotyrosine protein phosphatase |
Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
Type: | n/a |
Mol. Mass.: | 18042.81 |
Organism: | Homo sapiens (Human) |
Description: | P24666 |
Residue: | 158 |
Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
BDBM94981 |
---|
n/a |
---|
Name | BDBM94981 |
Synonyms: | 1-methyl-6H-pyrido[4,3-b]carbazole | MLS002920539 | SMR001798128 | cid_5382484 |
Type | Small organic molecule |
Emp. Form. | C16H12N2 |
Mol. Mass. | 232.2799 |
SMILES | Cc1nccc2cc3[nH]c4ccccc4c3cc12 |
Structure |
|