| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Probable nicotinate-nucleotide adenylyltransferase |
|---|
| Ligand | BDBM83190 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 18000±n/a nM |
|---|
| Citation |  PubChem, PC Dose response confirmation of uHTS inhibitor hits from NadD in a Colorimetric assay - Set 2 PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Probable nicotinate-nucleotide adenylyltransferase |
|---|
| Name: | Probable nicotinate-nucleotide adenylyltransferase |
|---|
| Synonyms: | NADD_STAAN | hypothetical protein SA1422 | nadD |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22100.53 |
|---|
| Organism: | Staphylococcus aureus subsp. aureus N315 |
|---|
| Description: | gi_15927174 |
|---|
| Residue: | 189 |
|---|
| Sequence: | MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMI
QMIIDELGFGDICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIE
YLKEMVTFVVVNRDKNSQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENY
IKGEGLYEH
|
|
|
|---|
| BDBM83190 |
|---|
| n/a |
|---|
| Name | BDBM83190 |
|---|
| Synonyms: | (3Z)-3-(2-furanylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylic acid [2-[2-cyanoethyl(methyl)amino]-2-oxoethyl] ester | (3Z)-3-(2-furfurylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylic acid [2-[2-cyanoethyl(methyl)amino]-2-keto-ethyl] ester | MLS002634234 | SMR001544486 | [2-[2-cyanoethyl(methyl)amino]-2-oxidanylidene-ethyl] (3Z)-3-(furan-2-ylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylate | [2-[2-cyanoethyl(methyl)amino]-2-oxoethyl] (3Z)-3-(furan-2-ylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylate | cid_44825359 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21N3O4 |
|---|
| Mol. Mass. | 415.4412 |
|---|
| SMILES | CN(CCC#N)C(=O)COC(=O)c1c2CC\C(=C\c3ccco3)c2nc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
