| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Ligand | BDBM95342 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 138599±n/a nM |
|---|
| Citation |  PubChem, PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Name: | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25822.90 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | gi_73586699 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
|---|
| BDBM95342 |
|---|
| n/a |
|---|
| Name | BDBM95342 |
|---|
| Synonyms: | (E,4Z)-4-[amino-[4-(4-methoxyphenyl)-1-piperazinyl]methylidene]-2-cyano-2-pentenedioic acid diethyl ester | (E,4Z)-4-[amino-[4-(4-methoxyphenyl)piperazino]methylene]-2-cyano-pent-2-enedioic acid diethyl ester | MLS000539532 | SMR000125190 | cid_9551595 | diethyl (E,4Z)-4-[amino-[4-(4-methoxyphenyl)piperazin-1-yl]methylidene]-2-cyanopent-2-enedioate | diethyl (E,4Z)-4-[azanyl-[4-(4-methoxyphenyl)piperazin-1-yl]methylidene]-2-cyano-pent-2-enedioate | diethyl 4-{amino[4-(4-methoxyphenyl)piperazino]methylene}-2-cyano-2-pentenedioate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N4O5 |
|---|
| Mol. Mass. | 428.4815 |
|---|
| SMILES | CCOC(=O)C(C=C(C(=O)OCC)C(=N)N1CCN(CC1)c1ccc(OC)cc1)C#N |w:6.5| |
|---|
| Structure | 
|
|---|
Search and Browse
