new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM95386
Substrate/Competitorn/a
IC50 91238±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95386
n/a
NameBDBM95386
Synonyms:4-[(9,10-diketo-2-anthryl)sulfonylamino]benzoic acid | 4-[(9,10-dioxo-2-anthracenyl)sulfonylamino]benzoic acid | 4-[(9,10-dioxoanthracen-2-yl)sulfonylamino]benzoic acid | 4-[[9,10-bis(oxidanylidene)anthracen-2-yl]sulfonylamino]benzoic acid | 4-{[(9,10-dioxo-9,10-dihydro-2-anthracenyl)sulfonyl]amino}benzoic acid | MLS000704597 | SMR000231989 | cid_7113151
TypeSmall organic molecule
Emp. Form.C21H13NO6S
Mol. Mass.407.396
SMILESOC(=O)c1ccc(NS(=O)(=O)c2ccc3C(=O)c4ccccc4C(=O)c3c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: