new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMSRA protein
LigandBDBM71037
Substrate/Competitorn/a
IC50 64326±n/a nM
Citation PubChem PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay (2013)[AID]
More Info.:Get all data from this article
 
MSRA protein
Name:MSRA protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25822.90
Organism:Bos taurus
Description:gi_73586699
Residue:233
Sequence:
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM71037
n/a
NameBDBM71037
Synonyms:2-methyl-3-(morpholine-4-carbonyl)benzo[f][1]benzofuran-4,9-dione | 2-methyl-3-(morpholine-4-carbonyl)benzo[f]benzofuran-4,9-quinone | 2-methyl-3-[4-morpholinyl(oxo)methyl]benzo[f]benzofuran-4,9-dione | 2-methyl-3-morpholin-4-ylcarbonyl-benzo[f][1]benzofuran-4,9-dione | MLS000419486 | SMR000320221 | cid_1382504
TypeSmall organic molecule
Emp. Form.C18H15NO5
Mol. Mass.325.3154
SMILESCc1oc2c(c1C(=O)N1CCOCC1)C(=O)c1ccccc1C2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: