| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Ligand | BDBM48038 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 62405±n/a nM |
|---|
| Citation |  PubChem, PC Absorbance-based biochemical high throughput dose response assay to identify inhibitors of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Name: | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25822.90 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | gi_73586699 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
|---|
| BDBM48038 |
|---|
| n/a |
|---|
| Name | BDBM48038 |
|---|
| Synonyms: | 4-[(E)-[3-(2-methylanilino)-4-oxo-1-naphthalenylidene]amino]sulfonylbenzoic acid | 4-[(E)-[3-(2-methylanilino)-4-oxonaphthalen-1-ylidene]amino]sulfonylbenzoic acid | 4-[(E)-[3-[(2-methylphenyl)amino]-4-oxidanylidene-naphthalen-1-ylidene]amino]sulfonylbenzoic acid | 4-[(E)-[4-keto-3-(o-toluidino)-1-naphthylidene]amino]sulfonylbenzoic acid | MLS000948152 | SMR000620455 | cid_6023693 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H18N2O5S |
|---|
| Mol. Mass. | 446.475 |
|---|
| SMILES | Cc1ccccc1NC1=CC(=NS(=O)(=O)c2ccc(cc2)C(O)=O)c2ccccc2C1=O |w:11.12,t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
