| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM51775 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 12100±n/a nM |
|---|
| Citation |  PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM51775 |
|---|
| n/a |
|---|
| Name | BDBM51775 |
|---|
| Synonyms: | 2-[2-[(N''E)-N''-[4-(2,4-dichlorobenzyl)oxy-3-ethoxy-benzylidene]hydrazino]-4-keto-2-thiazolin-5-yl]acetic acid | 2-[2-[(N'E)-N'-[4-(2,4-dichlorobenzyl)oxy-3-ethoxy-benzylidene]hydrazino]-4-keto-2-thiazolin-5-yl]acetic acid | 2-[2-[2-[[4-[(2,4-dichlorophenyl)methoxy]-3-ethoxy-phenyl]methylidene]hydrazinyl]-4-oxidanylidene-1,3-thiazol-5-yl]ethanoic acid | 2-[2-[2-[[4-[(2,4-dichlorophenyl)methoxy]-3-ethoxyphenyl]methylidene]hydrazinyl]-4-oxo-1,3-thiazol-5-yl]acetic acid | 2-[2-[2-[[4-[(2,4-dichlorophenyl)methoxy]-3-ethoxyphenyl]methylidene]hydrazinyl]-4-oxo-5-thiazolyl]acetic acid | 2-[2-[N'-[4-(2,4-dichlorobenzyl)oxy-3-ethoxy-benzylidene]hydrazino]-4-keto-2-thiazolin-5-yl]acetic acid | MLS000689950 | SMR000298668 | [2-({4-[(2,4-dichlorobenzyl)oxy]-3-ethoxybenzylidene}hydrazono)-4-oxo-1,3-thiazolidin-5-yl]acetic acid | cid_2908705 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19Cl2N3O5S |
|---|
| Mol. Mass. | 496.364 |
|---|
| SMILES | CCOc1cc(CN=Nc2nc(O)c(CC(O)=O)s2)ccc1OCc1ccc(Cl)cc1Cl |w:8.8| |
|---|
| Structure | 
|
|---|
Search and Browse
