Reaction Details |
| Report a problem with these data |
Target | Low molecular weight phosphotyrosine protein phosphatase |
---|
Ligand | BDBM46214 |
---|
Substrate/Competitor | n/a |
---|
IC50 | >80000±n/a nM |
---|
Citation | PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay PubChem Bioassay(2013)[AID] |
---|
More Info.: | Get all data from this article |
---|
|
Low molecular weight phosphotyrosine protein phosphatase |
---|
Name: | Low molecular weight phosphotyrosine protein phosphatase |
Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
Type: | n/a |
Mol. Mass.: | 18042.81 |
Organism: | Homo sapiens (Human) |
Description: | P24666 |
Residue: | 158 |
Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
BDBM46214 |
---|
n/a |
---|
Name | BDBM46214 |
Synonyms: | 2-[4-[[5-(4-chlorophenyl)-6-ethoxycarbonyl-7-methyl-3-oxidanylidene-5H-[1,3]thiazolo[3,2-a]pyrimidin-2-ylidene]methyl]phenoxy]ethanoic acid | 2-[4-[[5-(4-chlorophenyl)-6-ethoxycarbonyl-7-methyl-3-oxo-5H-[1,3]thiazolo[3,2-a]pyrimidin-2-ylidene]methyl]phenoxy]acetic acid | 2-[4-[[5-(4-chlorophenyl)-6-ethoxycarbonyl-7-methyl-3-oxo-5H-thiazolo[3,2-a]pyrimidin-2-ylidene]methyl]phenoxy]acetic acid | 2-[4-[[6-carbethoxy-5-(4-chlorophenyl)-3-keto-7-methyl-5H-thiazolo[3,2-a]pyrimidin-2-ylidene]methyl]phenoxy]acetic acid | MLS-0351016.0001 | cid_2878586 |
Type | Small organic molecule |
Emp. Form. | C25H21ClN2O6S |
Mol. Mass. | 512.962 |
SMILES | CCOC(=O)C1=C(C)N=c2sc(=Cc3ccc(OCC(O)=O)cc3)c(=O)n2C1c1ccc(Cl)cc1 |c:5,t:8| |
Structure |
|