| Reaction Details |
|---|
 | Report a problem with these data |
| Target | T cell receptor alpha variable 4 |
|---|
| Ligand | BDBM34278 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | >94099±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence-based biochemical primary high throughput dose response assay to identify inhibitors of T-cell receptor (TCR)-CD3 interaction using a TAMRA-labeled TCR probe PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| T cell receptor alpha variable 4 |
|---|
| Name: | T cell receptor alpha variable 4 |
|---|
| Synonyms: | TCRAV4S1 | TRAV4 | TVA4_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12216.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | A0A0B4J268 |
|---|
| Residue: | 109 |
|---|
| Sequence: | MRQVARVIVFLTLSTLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQG
PRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD
|
|
|
|---|
| BDBM34278 |
|---|
| n/a |
|---|
| Name | BDBM34278 |
|---|
| Synonyms: | 1-(3,4-dihydroxyphenyl)-2-[[4-ethyl-5-(2-methoxyphenyl)-1,2,4-triazol-3-yl]sulfanyl]ethanone | 1-(3,4-dihydroxyphenyl)-2-[[4-ethyl-5-(2-methoxyphenyl)-1,2,4-triazol-3-yl]thio]ethanone | 1-[3,4-bis(oxidanyl)phenyl]-2-[[4-ethyl-5-(2-methoxyphenyl)-1,2,4-triazol-3-yl]sulfanyl]ethanone | MLS000080517 | SMR000038049 | cid_665183 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H19N3O4S |
|---|
| Mol. Mass. | 385.437 |
|---|
| SMILES | CCn1c(SCC(=O)c2ccc(O)c(O)c2)nnc1-c1ccccc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
