| Reaction Details |
|---|
 | Report a problem with these data |
| Target | NH(3)-dependent NAD(+) synthetase |
|---|
| Ligand | BDBM98129 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | NADs HPLC Enzyme Assay |
|---|
| pH | 8.5±0 |
|---|
| Temperature | 277.15±0 K |
|---|
| IC50 | 143000±0.0 nM |
|---|
| Citation |  Moro, WB; Yang, Z; Kane, TA; Zhou, Q; Harville, S; Brouillette, CG; Brouillette, WJ SAR studies for a new class of antibacterial NAD biosynthesis inhibitors. J Comb Chem11:617-25 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| NH(3)-dependent NAD(+) synthetase |
|---|
| Name: | NH(3)-dependent NAD(+) synthetase |
|---|
| Synonyms: | BAS1855 | BA_1998 | GBAA_1998 | NADE_BACAN | Nicotinamide adenine dinucleotide synthetase (NADs) | nadE |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30092.16 |
|---|
| Organism: | Bacillus anthracis |
|---|
| Description: | Q81RP3 |
|---|
| Residue: | 272 |
|---|
| Sequence: | MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKKTGAKGFVLGISGGQDSTLAGRLAQ
LAVEEIRNEGGNATFIAVRLPYKVQKDEDDAQLALQFIQADQSVAFDIASTVDAFSNQYE
NLLDESLTDFNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLL
PLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKT
VPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
|
|
|
|---|
| BDBM98129 |
|---|
| n/a |
|---|
| Name | BDBM98129 |
|---|
| Synonyms: | 1-(3-nitrophenyl)-3-[4-[[4-(trifluoromethyl)phenyl]sulfonylamino]phenyl]urea | Compound ID 7{2,13} |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H15F3N4O5S |
|---|
| Mol. Mass. | 480.417 |
|---|
| SMILES | [O-][N+](=O)c1cccc(NC(=O)Nc2ccc(NS(=O)(=O)c3ccc(cc3)C(F)(F)F)cc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
