| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil gelatinase-associated lipocalin |
|---|
| Ligand | BDBM104014 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence quenching titrations |
|---|
| pH | 7.4±n/a |
|---|
| Kd | 18±2 nM |
|---|
| Citation |  Allred, BE; Correnti, C; Clifton, MC; Strong, RK; Raymond, KN Siderocalin outwits the coordination chemistry of vibriobactin, a siderophore of Vibrio cholerae. ACS Chem Biol8:1882-7 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Neutrophil gelatinase-associated lipocalin |
|---|
| Name: | Neutrophil gelatinase-associated lipocalin |
|---|
| Synonyms: | HNL | LCN2 | NGAL | NGAL_HUMAN | Siderocalin (Scn) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22594.34 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P80188 |
|---|
| Residue: | 198 |
|---|
| Sequence: | MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG
|
|
|
|---|
| BDBM104014 |
|---|
| n/a |
|---|
| Name | BDBM104014 |
|---|
| Synonyms: | Vibriobactin A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H43N5O13 |
|---|
| Mol. Mass. | 741.7416 |
|---|
| SMILES | C[C@@H](O)[C@H](NC(=O)c1cccc(O)c1O)C(=O)NCCCN(CCCNC(=O)c1cccc(O)c1O)C(=O)[C@@H](NC(=O)c1cccc(O)c1O)[C@@H](C)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
