Reaction Details |
| Report a problem with these data |
Target | Histone H1.0 |
---|
Ligand | BDBM35254 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 2±0.0 nM |
---|
Citation | Mates, S; Fienberg, A; Wennogle, L Methods and compositions for sleep disorders and other disorders US Patent US8598119 Publication Date 12/3/2013 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histone H1.0 |
---|
Name: | Histone H1.0 |
Synonyms: | H1-0 | H10_HUMAN | H1F0 | H1FV | Histone H1 |
Type: | Cell-surface receptors |
Mol. Mass.: | 20917.09 |
Organism: | Homo sapiens (Human) |
Description: | P07305 |
Residue: | 194 |
Sequence: | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK
|
|
|
BDBM35254 |
---|
n/a |
---|
Name | BDBM35254 |
Synonyms: | 2-methyl-4-(4-methylpiperazin-1-yl)-10H-thieno[2,3-b][1,5]benzodiazepine | CHEMBL715 | Olansek | US8802672, Olanzapine | Zyprexa | olanzapine |
Type | Small organic molecule |
Emp. Form. | C17H20N4S |
Mol. Mass. | 312.432 |
SMILES | CN1CCN(CC1)C1=Nc2ccccc2Nc2sc(C)cc12 |t:8| |
Structure |
|