| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM108365 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminometric Kinase Assay |
|---|
| pH | 7±0 |
|---|
| IC50 | 8.85±0.0 nM |
|---|
| Citation |  Brzózka, K; Czardybon, W; Sabiniarz, A; Millik, M; Windak, R; Zarebski, A; Beuzen, N Compound, a process for its preparation, a pharmaceutical composition, use of a compound, a method for modulating or regulating serine/threonine kinases and a serine/threonine kinases modulating agent US Patent US8604217 Publication Date 12/10/2013 |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM108365 |
|---|
| n/a |
|---|
| Name | BDBM108365 |
|---|
| Synonyms: | US8604217, 61 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H12Br4N4 |
|---|
| Mol. Mass. | 519.856 |
|---|
| SMILES | NCCCCNc1nc2c(Br)c(Br)c(Br)c(Br)c2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
