Reaction Details |
| Report a problem with these data |
Target | Ribonuclease pancreatic |
---|
Ligand | BDBM111447 |
---|
Substrate/Competitor | n/a |
---|
Ki | 3.80e+5± 2e+3 nM |
---|
Citation | Debnath, J; Dasgupta, S; Pathak, T Amino and carboxy functionalized modified nucleosides: a potential class of inhibitors for angiogenin. Bioorg Chem52:56-61 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Ribonuclease pancreatic |
---|
Name: | Ribonuclease pancreatic |
Synonyms: | RIB1 | RNAS1_HUMAN | RNASE1 | RNAse A | RNS1 | Ribonuclease A | Ribonuclease pancreatic |
Type: | Protein |
Mol. Mass.: | 17653.66 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 156 |
Sequence: | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
|
|
|
BDBM111447 |
---|
n/a |
---|
Name | BDBM111447 |
Synonyms: | N-[2-Hydroxymethyl-5-(5-methyl-2,4-dioxo-3,4-dihydro- 2H-pyrimidin-1-yl)-tetrahydro-furan-3-yl]-malonamic acid (Compound 6) |
Type | Small organic molecule |
Emp. Form. | C13H17N3O7 |
Mol. Mass. | 327.29 |
SMILES | Cc1cn([C@H]2C[C@@H](NC(=O)CC(O)=O)[C@@H](CO)O2)c(=O)[nH]c1=O |r| |
Structure |
|