| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Angiogenin |
|---|
| Ligand | BDBM111445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Kinetics with Angiogenin |
|---|
| pH | 6±n/a |
|---|
| Ki | 1.251e+6± 4e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Debnath, J; Dasgupta, S; Pathak, T Amino and carboxy functionalized modified nucleosides: a potential class of inhibitors for angiogenin. Bioorg Chem52:56-61 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Angiogenin |
|---|
| Name: | Angiogenin |
|---|
| Synonyms: | ANG | ANGI_HUMAN | RNASE5 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 16563.00 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 147 |
|---|
| Sequence: | MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
TAGFRNVVVACENGLPVHLDQSIFRRP
|
|
|
|---|
| BDBM111445 |
|---|
| n/a |
|---|
| Name | BDBM111445 |
|---|
| Synonyms: | Tyr-aT (Compound 3) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24N4O6 |
|---|
| Mol. Mass. | 404.4171 |
|---|
| SMILES | Cc1cn([C@H]2C[C@@H](NC(=O)C(N)Cc3ccc(O)cc3)[C@@H](CO)O2)c(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
