| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Ligand | BDBM48038 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Epi Absorbance-based biochemical high throughput dose response assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2) |
|---|
| IC50 | 1411±n/a nM |
|---|
| Citation |  PubChem, PC Epi Absorbance-based biochemical high throughput dose response assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2) PubChem Bioassay(2014)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Name: | Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Synonyms: | EAP2 | EAPII | ETS1-associated protein 2 | ETS1-associated protein II | TDP2 | TRAF and TNF receptor-associated protein | TTRAP | TYDP2_HUMAN | Tyr-DNA phosphodiesterase 2 | Tyrosyl-DNA phosphodiesterase 2 | Tyrosyl-DNA phosphodiesterase 2 (hTDP2) | Tyrosyl-RNA phosphodiesterase | VPg unlinkase | hTDP2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40916.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_23510348 |
|---|
| Residue: | 362 |
|---|
| Sequence: | MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNS
YFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWN
IDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFT
AIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQ
LKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ
MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDI
IL
|
|
|
|---|
| BDBM48038 |
|---|
| n/a |
|---|
| Name | BDBM48038 |
|---|
| Synonyms: | 4-[(E)-[3-(2-methylanilino)-4-oxo-1-naphthalenylidene]amino]sulfonylbenzoic acid | 4-[(E)-[3-(2-methylanilino)-4-oxonaphthalen-1-ylidene]amino]sulfonylbenzoic acid | 4-[(E)-[3-[(2-methylphenyl)amino]-4-oxidanylidene-naphthalen-1-ylidene]amino]sulfonylbenzoic acid | 4-[(E)-[4-keto-3-(o-toluidino)-1-naphthylidene]amino]sulfonylbenzoic acid | MLS000948152 | SMR000620455 | cid_6023693 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H18N2O5S |
|---|
| Mol. Mass. | 446.475 |
|---|
| SMILES | Cc1ccccc1NC1=CC(=NS(=O)(=O)c2ccc(cc2)C(O)=O)c2ccccc2C1=O |w:11.12,t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
