| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibrinogen beta chain [164-491] |
|---|
| Ligand | BDBM114665 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors that disrupt the binding of a cyclic peptide (Tn6) to the fibrin proteolytic product D-Dimer |
|---|
| IC50 | 9103±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors that disrupt the binding of a cyclic peptide (Tn6) to the fibrin proteolytic product D-Dimer and fragment E complex [DD(E )] PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Fibrinogen beta chain [164-491] |
|---|
| Name: | Fibrinogen beta chain [164-491] |
|---|
| Synonyms: | Chain E, Fragment Double-D From Human Fibrin | FGB | FIBB_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37647.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_28373962 |
|---|
| Residue: | 328 |
|---|
| Sequence: | DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYC
RTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQ
NRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIE
MEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGM
FFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDD
GVVWMNWKGSWYSMRKMSMKIRPFFPQQ
|
|
|
|---|
| BDBM114665 |
|---|
| n/a |
|---|
| Name | BDBM114665 |
|---|
| Synonyms: | 1,5-bis[3-(2-hydroxyethylamino)propylamino]-9,10-anthraquinone | 1,5-bis[3-(2-hydroxyethylamino)propylamino]anthracene-9,10-dione | MLS002701865 | SMR001565456 | cid_335352 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H32N4O4 |
|---|
| Mol. Mass. | 440.5353 |
|---|
| SMILES | OCCNCCCNc1cccc2C(=O)c3c(NCCCNCCO)cccc3C(=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
