| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histone deacetylase 8 |
|---|
| Ligand | BDBM19149 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | HDAC8 Inhibition Assay (spectrofluorometric titration) |
|---|
| pH | 7.5±n/a |
|---|
| Kd | 1.2e+3± 2e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Singh, RK; Lall, N; Leedahl, TS; McGillivray, A; Mandal, T; Haldar, M; Mallik, S; Cook, G; Srivastava, DK Kinetic and thermodynamic rationale for suberoylanilide hydroxamic acid being a preferential human histone deacetylase 8 inhibitor as compared to the structurally similar ligand, trichostatin a. Biochemistry52:8139-49 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histone deacetylase 8 |
|---|
| Name: | Histone deacetylase 8 |
|---|
| Synonyms: | HD8 | HDAC8 | HDAC8_HUMAN | HDACL1 | Histone deacetylase 8 (HDAC-8) | Human HDAC8 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41749.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9BY41 |
|---|
| Residue: | 377 |
|---|
| Sequence: | MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
|
|
|
|---|
| BDBM19149 |
|---|
| n/a |
|---|
| Name | BDBM19149 |
|---|
| Synonyms: | CHEMBL98 | N-hydroxy-N'-phenyloctanediamide | SAHA | US10011611, SAHA | US10188756, Compound SAHA | US11207431, SAHA | US11505523, Compound SAHA | US9115116, SAHA | US9353061, SAHA | US9428447, SAHA | US9695181, Vorinostat | Vorinostat | Zolinza | cid_5311 | suberoylanilide hydroxamic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H20N2O3 |
|---|
| Mol. Mass. | 264.3202 |
|---|
| SMILES | ONC(=O)CCCCCCC(=O)Nc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
