Reaction Details |
| Report a problem with these data |
Target | Histone deacetylase 8 |
---|
Ligand | BDBM19149 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | HDAC8 Inhibition Assay (spectrofluorometric titration) |
---|
pH | 7.5±n/a |
---|
Kd | 1.2e+3± 2e+2 nM |
---|
Comments | extracted |
---|
Citation | Singh, RK; Lall, N; Leedahl, TS; McGillivray, A; Mandal, T; Haldar, M; Mallik, S; Cook, G; Srivastava, DK Kinetic and thermodynamic rationale for suberoylanilide hydroxamic acid being a preferential human histone deacetylase 8 inhibitor as compared to the structurally similar ligand, trichostatin a. Biochemistry52:8139-49 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histone deacetylase 8 |
---|
Name: | Histone deacetylase 8 |
Synonyms: | HD8 | HDAC8 | HDAC8_HUMAN | HDACL1 | Histone deacetylase 8 (HDAC-8) | Human HDAC8 |
Type: | Enzyme |
Mol. Mass.: | 41749.60 |
Organism: | Homo sapiens (Human) |
Description: | Q9BY41 |
Residue: | 377 |
Sequence: | MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
|
|
|
BDBM19149 |
---|
n/a |
---|
Name | BDBM19149 |
Synonyms: | CHEMBL98 | N-hydroxy-N'-phenyloctanediamide | SAHA | US10011611, SAHA | US10188756, Compound SAHA | US11207431, SAHA | US11505523, Compound SAHA | US9115116, SAHA | US9353061, SAHA | US9428447, SAHA | US9695181, Vorinostat | Vorinostat | Zolinza | cid_5311 | suberoylanilide hydroxamic acid |
Type | Small organic molecule |
Emp. Form. | C14H20N2O3 |
Mol. Mass. | 264.3202 |
SMILES | ONC(=O)CCCCCCC(=O)Nc1ccccc1 |
Structure |
|