Reaction Details |
| Report a problem with these data |
Target | Core-binding factor subunit beta |
---|
Ligand | BDBM123672 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FRET Assay |
---|
IC50 | 700±n/a nM |
---|
Citation | Bushweller, JH; Grembecka, J; Illendula, A; Dixon, L Inhibitors of inv(16) leukemia US Patent US8748618 Publication Date 6/10/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Core-binding factor subunit beta |
---|
Name: | Core-binding factor subunit beta |
Synonyms: | CBFB | Core-binding factor subunit beta (CBFB) | PEBB_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 21507.90 |
Organism: | Homo sapiens (Human) |
Description: | Q13951 |
Residue: | 182 |
Sequence: | MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT
RP
|
|
|
BDBM123672 |
---|
n/a |
---|
Name | BDBM123672 |
Synonyms: | US8748618, AI-4-49 |
Type | Small organic molecule |
Emp. Form. | C12H7Cl2N3 |
Mol. Mass. | 264.11 |
SMILES | Clc1cc(Cl)c2[nH]c(nc2c1)-c1ccccn1 |
Structure |
|