Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM123686
Substrate/Competitorn/a
Meas. Tech.In Vitro Inhibition Assay
pH7.5±n/a
IC50 5±n/a nM
Commentsextracted
Citation Hendrix MBöβ FBurkhardt NErb CTersteegen AVan Kampen M Alkyl-substituted pyrazolopyrimidines US Patent  US8741907 Publication Date 6/3/2014
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:3',5'-cyclic phosphodiesterase
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (Human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123686
n/a
NameBDBM123686
Synonyms:US8741907, 1
TypeSmall organic molecule
Emp. Form.C17H24N4O
Mol. Mass.300.3987
SMILESO=c1[nH]c(CC2CCCCC2)nc2n(ncc12)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: