| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nicotinate-nucleotide adenylyltransferase |
|---|
| Ligand | BDBM81360 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 170000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Mackerell, Jr., A; Zhang, H; Osterman, A; Kolhatkar, R Targeting NAD biosynthesis in bacterial pathogens US Patent US8785499 Publication Date 7/22/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nicotinate-nucleotide adenylyltransferase |
|---|
| Name: | Nicotinate-nucleotide adenylyltransferase |
|---|
| Synonyms: | Deamido-NAD(+) pyrophosphorylase | NADD_ECOLI | Nicotinate mononucleotide adenylyltransferase (NadD) | Nicotinate-nucleotide adenylyltransferase (NadD) | nadD | ybeN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24523.61 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | P0A752 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHML
ELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEY
ETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNIS
ATIIRERLQNGESCEDLLPEPVLTYINQQGLYR
|
|
|
|---|
| BDBM81360 |
|---|
| n/a |
|---|
| Name | BDBM81360 |
|---|
| Synonyms: | NadD inhibitor 3_17 | US8785499, 3_17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13ClN4OS |
|---|
| Mol. Mass. | 380.851 |
|---|
| SMILES | Nc1c(sc2nc(ccc12)-c1ccncc1)C(=O)Nc1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
