Reaction Details |
| Report a problem with these data |
Target | Protein UL24 homolog |
---|
Ligand | BDBM36460 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Nuclear Magnetic Resonance (NMR) Assay |
---|
pH | 8±n/a |
---|
IC50 | 1.5e+3± 3e+2 nM |
---|
Comments | extracted |
---|
Citation | Gable, JE; Lee, GM; Jaishankar, P; Hearn, BR; Waddling, CA; Renslo, AR; Craik, CS Broad-spectrum allosteric inhibition of herpesvirus proteases. Biochemistry53:4648-60 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein UL24 homolog |
---|
Name: | Protein UL24 homolog |
Synonyms: | Kaposi's sarcoma-associated herpesvirus protease (KSHV Pr) | ORF20 | UL24_HHV8P |
Type: | Protein |
Mol. Mass.: | 28447.41 |
Organism: | Human herpesvirus 8 |
Description: | Q2HRB2 |
Residue: | 257 |
Sequence: | MVRPTEAEVKKSLSRLPAARKRAGNRAHLATYRRLLKYSTLPDLWRFLSSRPQNPPLGHH
RLFFEVTLGHRIADCVILVSGGHQPVCYVVELKTCLSHQLIPTNTVRTSQRAQGLCQLSD
SIHYIAHSAPPGTEAWTITPLLIFKNQKTLKTVYSESPGAFPTPVHTTEGKLCAFLTARE
NADIRKVLSKVPKKPKMDRGGKILGPTPGKRAVYSQAHHGRNKKGRPWTAQPTRAKSRTK
DKGTPAFPRAGPACSGP
|
|
|
BDBM36460 |
---|
n/a |
---|
Name | BDBM36460 |
Synonyms: | 3-Benzyl-4-(6-(cyclohexylmethyl)picolinamido)benzoic acid, 2 | CID42628632 | DD2 |
Type | Small organic moelcule |
Emp. Form. | C27H28N2O3 |
Mol. Mass. | 428.5228 |
SMILES | OC(=O)c1ccc(NC(=O)c2cccc(CC3CCCCC3)n2)c(Cc2ccccc2)c1 |
Structure |
|