Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C isoform 1
LigandBDBM285583
Substrate/Competitorn/a
Meas. Tech.The PDE4A3, PDE4B1, PDE4C1 and PDE4D3 assays
IC50 84.5±n/a nM
Citation Chappie TAPatel NCHayward MMHelal CJSciabola SLaChapelle EAYoung JMVerhoest PR Imidazopyridazine compounds US Patent  US10077269 Publication Date 9/18/2018
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C isoform 1
Name:Isoform 3 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:NP_000914.2 | PDE4C1 | PDE4D3 | PDE4E3 | Q08499-2
Type:n/a
Mol. Mass.:76431.39
Organism:Homo sapiens (Human)
Description:Q08499-2
Residue:673
Sequence:
MMHVNNFPFRRHSWICFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSD
SDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSP
MCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNREL
THLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSL
TNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKT
FKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAI
FASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTK
KQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMV
HCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFID
YIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQF
ELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQ
PEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285583
n/a
NameBDBM285583
Synonyms:US10077269, Example 56 | US9598421, Example 56 | azetidin-1-yl[3-(4-chloro-2-methylphenyl)imidazo[1,2-b]pyridazin-2-yl]methanone
TypeSmall organic molecule
Emp. Form.C17H15ClN4O
Mol. Mass.326.78
SMILESCc1cc(Cl)ccc1-c1c(nc2cccnn12)C(=O)N1CCC1 |(-2.46,1.44,;-.98,1.83,;-.58,3.32,;.91,3.72,;1.31,5.21,;2,2.63,;1.6,1.14,;.11,.75,;-.29,-.74,;.62,-1.99,;-.29,-3.23,;-1.75,-2.76,;-3.08,-3.53,;-4.42,-2.76,;-4.42,-1.22,;-3.08,-.45,;-1.75,-1.22,;2.16,-1.99,;2.93,-.65,;2.93,-3.32,;2.53,-4.81,;4.02,-5.21,;4.42,-3.72,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: