Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine nucleoside phosphorylase
LigandBDBM136304
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature298.15±n/a K
Kd 84±n/a nM
Commentsextracted
Citation Clinch KEvans GBFurneaux RHGulab SAKelly PMSchramm VLTyler PCWoolhouse AD Acyclic amine inhibitors of nucleoside phosphorylases and hydrolases US Patent  US8853224 Publication Date 10/7/2014
More Info.:Get all data from this article,  Assay Method
 
Purine nucleoside phosphorylase
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:Enzyme
Mol. Mass.:32119.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM136304
n/a
NameBDBM136304
Synonyms:US8853224, 20.5
TypeSmall organic molecule
Emp. Form.C11H16N4O4
Mol. Mass.268.2691
SMILESOCC(O)C(O)CNCc1c[nH]c2c1nc[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: