| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Purine nucleoside phosphorylase |
|---|
| Ligand | BDBM136303 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| Kd | 2000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Clinch, K; Evans, GB; Furneaux, RH; Gulab, SA; Kelly, PM; Schramm, VL; Tyler, PC; Woolhouse, AD Acyclic amine inhibitors of nucleoside phosphorylases and hydrolases US Patent US8853224 Publication Date 10/7/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Purine nucleoside phosphorylase |
|---|
| Name: | Purine nucleoside phosphorylase |
|---|
| Synonyms: | Purine Nucleoside Phosphorylase (PNP) | pfPNP |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26857.85 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
|
|
|
|---|
| BDBM136303 |
|---|
| n/a |
|---|
| Name | BDBM136303 |
|---|
| Synonyms: | US8853224, 3.4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H20N4O3 |
|---|
| Mol. Mass. | 328.3657 |
|---|
| SMILES | OC[C@H](O)CN(Cc1c[nH]c2c1nc[nH]c2=O)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
