Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM50384774
Substrate/Competitorn/a
Meas. Tech.Inhibitory Assay
IC50 11000±n/a nM
Citation Neubig RBlazer LHusbands SLarsen STraynor J Small molecule inhibitors of RGS proteins US Patent  US8865750 Publication Date 10/21/2014
More Info.:Get all data from this article,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384774
n/a
NameBDBM50384774
Synonyms:CHEMBL1917204
TypeSmall organic molecule
Emp. Form.C16H13FN2O2S
Mol. Mass.316.35
SMILESCc1ccc(cc1)-n1sc(=O)n(Cc2ccc(F)cc2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: