| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 16 |
|---|
| Ligand | BDBM50384774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibitory Assay |
|---|
| IC50 | 3500±n/a nM |
|---|
| Citation |  Neubig, R; Blazer, L; Husbands, S; Larsen, S; Traynor, J Small molecule inhibitors of RGS proteins US Patent US8865750 Publication Date 10/21/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Regulator of G-protein signaling 16 |
|---|
| Name: | Regulator of G-protein signaling 16 |
|---|
| Synonyms: | RGS16 | RGS16_HUMAN | RGSR | Regulator of G-protein signaling 16 (RGS16) | regulator of G-protein signalling 16 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22748.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_156416009 |
|---|
| Residue: | 202 |
|---|
| Sequence: | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
|
|
|
|---|
| BDBM50384774 |
|---|
| n/a |
|---|
| Name | BDBM50384774 |
|---|
| Synonyms: | CHEMBL1917204 | US20230414581, Compound 6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13FN2O2S |
|---|
| Mol. Mass. | 316.35 |
|---|
| SMILES | Cc1ccc(cc1)-n1sc(=O)n(Cc2ccc(F)cc2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
