| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 4 |
|---|
| Ligand | BDBM136368 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibitory Assay |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Neubig, R; Blazer, L; Husbands, S; Larsen, S; Traynor, J Small molecule inhibitors of RGS proteins US Patent US8865750 Publication Date 10/21/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Regulator of G-protein signaling 4 |
|---|
| Name: | Regulator of G-protein signaling 4 |
|---|
| Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23263.51 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49798 |
|---|
| Residue: | 205 |
|---|
| Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
|---|
| BDBM136368 |
|---|
| n/a |
|---|
| Name | BDBM136368 |
|---|
| Synonyms: | US8865750, CCG- 203778 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18N2O2 |
|---|
| Mol. Mass. | 294.3477 |
|---|
| SMILES | Cc1ccc(CN2C(=O)CN(C2=O)c2ccc(C)cc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
