Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 8 |
---|
Ligand | BDBM136369 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibitory Assay |
---|
IC50 | >100000±n/a nM |
---|
Citation | Neubig, R; Blazer, L; Husbands, S; Larsen, S; Traynor, J Small molecule inhibitors of RGS proteins US Patent US8865750 Publication Date 10/21/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Regulator of G-protein signaling 8 |
---|
Name: | Regulator of G-protein signaling 8 |
Synonyms: | RGS8 | RGS8_HUMAN | Regulator of G-protein signaling 8 (RGS8) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 20925.80 |
Organism: | Homo sapiens (Human) |
Description: | gi_74355113 |
Residue: | 180 |
Sequence: | MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
|
|
|
BDBM136369 |
---|
n/a |
---|
Name | BDBM136369 |
Synonyms: | US8865750, CCG- 203780 |
Type | Small organic molecule |
Emp. Form. | C11H8BrNO2 |
Mol. Mass. | 266.091 |
SMILES | BrC1=CC(=O)N(Cc2ccccc2)C1=O |t:1| |
Structure |
|