| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM286029 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | mPGES1 enzyme assay |
|---|
| IC50 | 5.14±n/a nM |
|---|
| Citation |  Li, X; He, W; Liu, X; Wang, B; Hu, Q; Jin, F; Dong, Q; Sun, P Amide derivatives and pharmaceutically acceptable salts thereof, preparation method thereof and medicinal application thereof US Patent US10081629 Publication Date 9/25/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM286029 |
|---|
| n/a |
|---|
| Name | BDBM286029 |
|---|
| Synonyms: | 2-Chloro-N-(2(4-fluorophenyl)-1-methyl-1H-indol-5-yl)-5-((2,2-dimethylpropanoylamino)methyl)benzamide | US10081629, Example 11 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H27ClFN3O2 |
|---|
| Mol. Mass. | 491.984 |
|---|
| SMILES | Cn1c(cc2cc(NC(=O)c3cc(CNC(=O)C(C)(C)C)ccc3Cl)ccc12)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
