| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase SHV-1 |
|---|
| Ligand | BDBM152696 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Steady-State Kinetics Assay |
|---|
| pH | 7.4±n/a |
|---|
| Ki | 5.6e+2± 5e+1 nM |
|---|
| IC50 | 3.2e+2± 3e+1 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Che, T; Rodkey, EA; Bethel, CR; Shanmugam, S; Ding, Z; Pusztai-Carey, M; Nottingham, M; Chai, W; Buynak, JD; Bonomo, RA; van den Akker, F; Carey, PR Detecting a quasi-stable imine species on the reaction pathway of SHV-1 ß-lactamase and 6ß-(hydroxymethyl)penicillanic acid sulfone. Biochemistry54:734-43 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-lactamase SHV-1 |
|---|
| Name: | Beta-lactamase SHV-1 |
|---|
| Synonyms: | BLA1_KLEPN | Beta-lactamase SHV-1 | SHV-1 beta-lactamase | bla | shv1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31226.68 |
|---|
| Organism: | Klebsiella pneumoniae (Enterobacteria) |
|---|
| Description: | 4R3B |
|---|
| Residue: | 286 |
|---|
| Sequence: | MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
|
|
|
|---|
| BDBM152696 |
|---|
| n/a |
|---|
| Name | BDBM152696 |
|---|
| Synonyms: | PSR-3-283A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H12NO6S |
|---|
| Mol. Mass. | 262.26 |
|---|
| SMILES | [H][C@@]12[C@H](CO)C(=O)N1[C@@H](C([O-])=O)C(C)(C)S2(=O)=O |r,@@:12| |
|---|
| Structure | 
|
|---|
Search and Browse
