Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, intestinal |
---|
Ligand | BDBM85511 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ITC Titration |
---|
pH | 8±0 |
---|
Temperature | 310.15±0 K |
---|
Kd | 5.67e+4± 3.27e+3 nM |
---|
Citation | Patil, R; Laguerre, A; Wielens, J; Headey, SJ; Williams, ML; Hughes, ML; Mohanty, B; Porter, CJ; Scanlon, MJ Characterization of two distinct modes of drug binding to human intestinal fatty acid binding protein. ACS Chem Biol9:2526-34 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, intestinal |
---|
Name: | Fatty acid-binding protein, intestinal |
Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
Type: | Protein |
Mol. Mass.: | 15207.56 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 132 |
Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
BDBM85511 |
---|
n/a |
---|
Name | BDBM85511 |
Synonyms: | CAS_74103-07-4 | KETOROLAC | Ketorolac tris salt | Toradol |
Type | Small organic molecule |
Emp. Form. | C15H13NO3 |
Mol. Mass. | 255.2686 |
SMILES | OC(=O)C1CCn2c1ccc2C(=O)c1ccccc1 |
Structure |
|