Reaction Details |
| Report a problem with these data |
Target | Rhomboid domain-containing protein |
---|
Ligand | BDBM50199883 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Activity-based Protein Profiling (ABPP) |
---|
pH | 7.4±0 |
---|
Temperature | 310.15±0 K |
---|
IC50 | 1.6e+4± 5e+3 nM |
---|
Citation | Wolf, EV; Zeissler, A; Verhelst, SH Inhibitor Fingerprinting of Rhomboid Proteases by Activity-Based Protein Profiling Reveals Inhibitor Selectivity and Rhomboid Autoprocessing. ACS Chem Biol10:2325-33 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Rhomboid domain-containing protein |
---|
Name: | Rhomboid domain-containing protein |
Synonyms: | Rhomboid protease (PhROM) |
Type: | Protein |
Mol. Mass.: | 22001.99 |
Organism: | Pyrococcus horikoshii (Euryarchaeotes) |
Description: | O59166 |
Residue: | 197 |
Sequence: | MKDLRLHKYFPGTFSLIILTTLVFIYELVVGFDRAIQELAQINGLVTLGQWWRLITAIFL
HMGFIHFGLNIFWLFYLGIDLEGIVGTRRFLTVFFASALVGNLLSLITLPPYVASGGASG
GLFGVVGALLGIEGVLRRNIQKALINALLLFLINSIFPGVNAVAHFGGLVTGLIFGYYYG
KWLRRKMLDMSYWLEVS
|
|
|
BDBM50199883 |
---|
n/a |
---|
Name | BDBM50199883 |
Synonyms: | 3,4‐Dichloroisocoumarin (2) | 3,4-Dichloro-isochromen-1-one | 3,4-dichloro-1H-isochromen-1-one | 3,4-dichloroisocoumarin | CHEMBL24983 | cid_1609 |
Type | Small organic molecule |
Emp. Form. | C9H4Cl2O2 |
Mol. Mass. | 215.033 |
SMILES | Clc1oc(=O)c2ccccc2c1Cl |
Structure |
|