| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Rhomboid domain-containing protein |
|---|
| Ligand | BDBM165197 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Activity-based Protein Profiling (ABPP) |
|---|
| pH | 7.4±0 |
|---|
| Temperature | 310.15±0 K |
|---|
| IC50 | 4.8e+4± 1.0e+4 nM |
|---|
| Citation |  Wolf, EV; Zeissler, A; Verhelst, SH Inhibitor Fingerprinting of Rhomboid Proteases by Activity-Based Protein Profiling Reveals Inhibitor Selectivity and Rhomboid Autoprocessing. ACS Chem Biol10:2325-33 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Rhomboid domain-containing protein |
|---|
| Name: | Rhomboid domain-containing protein |
|---|
| Synonyms: | Rhomboid protease (TmROM) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26404.64 |
|---|
| Organism: | Thermotoga maritima (Thermotogales) |
|---|
| Description: | Q9WZ53 |
|---|
| Residue: | 235 |
|---|
| Sequence: | MRKRAVYFILLFNAFIFVMMTFSGVFSTRDPVLQMLLLLRYGAQYGPRVDAGDWFRLITA
LFVHGGILHILFNSYALYYFGLIVEDIYGTEKFLVGYFFTGIVGNLATHVFYHDTISVGA
SGAIFGLIGILFAAGFRKDTPFFMKPVTGVSLLPIILINVVYGFLPGTNINNAAHLGGFL
SGMLLGYTMSPFSWKRRTLWRVLAIAVVLLVVLSYIFLIRQIPEIDEAIRRFKAG
|
|
|
|---|
| BDBM165197 |
|---|
| n/a |
|---|
| Name | BDBM165197 |
|---|
| Synonyms: | (4S)‐3‐butyl‐4‐(pent‐4‐yn‐1‐yl)oxetan‐2‐one (48) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H18O2 |
|---|
| Mol. Mass. | 194.2701 |
|---|
| SMILES | CCCC[C@H]1[C@H](CCCC#C)OC1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
