Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM163848 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Electrophysiology Assay |
---|
pH | 7.4±n/a |
---|
IC50 | 110±n/a nM |
---|
Comments | extracted |
---|
Citation | Pasternak, A; Blizzard, T; Chobanian, H; de Jesus, R; Ding, F; Dong, S; Gude, C; Kim, D; Tang, H; Walsh, S; Pio, B; Jiang, J Inhibitors of the renal outer medullary potassium channel US Patent US9062070 Publication Date 6/23/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
Type: | Enzyme |
Mol. Mass.: | 44976.27 |
Organism: | Rattus norvegicus (Rat) |
Description: | P35560 |
Residue: | 391 |
Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
BDBM163848 |
---|
n/a |
---|
Name | BDBM163848 |
Synonyms: | US9062070, 103 | US9062070, 104 |
Type | Small organic molecule |
Emp. Form. | C25H26FN9O |
Mol. Mass. | 487.532 |
SMILES | Cc1c(ccc(F)c1[N+]#[C-])[C@H]1CN2CCN(C[C@@H]2CN1)C(=O)C1CCc2cc(ncc12)-n1cnnn1 |r| |
Structure |
|