Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM166440 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 7.4±n/a |
---|
IC50 | 158800±n/a nM |
---|
Comments | extracted |
---|
Citation | Hsieh, P; Hwang, T; Wang, W; Wang, T Oxime-based compound, pharmaceutical composition containing the same and method for preparing the same US Patent US9073833 Publication Date 7/7/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM166440 |
---|
n/a |
---|
Name | BDBM166440 |
Synonyms: | US9073833, 7 |
Type | Small organic molecule |
Emp. Form. | C22H28N2O6S |
Mol. Mass. | 448.533 |
SMILES | C\C(=N/OCCCO)c1ccccc1NS(=O)(=O)c1ccc(OC(=O)C(C)(C)C)cc1 |
Structure |
|