Reaction Details |
| Report a problem with these data |
Target | Alpha-synuclein |
---|
Ligand | BDBM170547 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Competitive Binding Assay |
---|
pH | 7.4±n/a |
---|
Ki | 283±n/a nM |
---|
Comments | extracted |
---|
Citation | Luke, EA; Yadon, MC; Cummings, J; Hudson, FM; Lake, T; Hu, Q; Cam, J; Snow, AD Compounds for the treatment of neurodegenerative diseases US Patent US9085549 Publication Date 7/21/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Alpha-synuclein |
---|
Name: | Alpha-synuclein |
Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
Type: | Protein |
Mol. Mass.: | 14451.42 |
Organism: | Homo sapiens (Human) |
Description: | P37840 |
Residue: | 140 |
Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
BDBM170547 |
---|
n/a |
---|
Name | BDBM170547 |
Synonyms: | US9085549, 63 |
Type | Small organic molecule |
Emp. Form. | C16H12O5S |
Mol. Mass. | 316.328 |
SMILES | Oc1ccc(cc1O)-c1ccc(s1)-c1cc(O)c(O)c(O)c1 |
Structure |
|