| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM170557 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competitive Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Ki | 466±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Luke, EA; Yadon, MC; Cummings, J; Hudson, FM; Lake, T; Hu, Q; Cam, J; Snow, AD Compounds for the treatment of neurodegenerative diseases US Patent US9085549 Publication Date 7/21/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM170557 |
|---|
| n/a |
|---|
| Name | BDBM170557 |
|---|
| Synonyms: | US9085549, 67 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10N2O5 |
|---|
| Mol. Mass. | 286.2396 |
|---|
| SMILES | Oc1ccc(cc1O)-c1nnc(o1)-c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
