| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM171374 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Ki | 1±n/a nM |
|---|
| Citation |  Ghosh, AK Nonpeptide HIV-1 protease inhibitors US Patent US9085571 Publication Date 7/21/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM171374 |
|---|
| n/a |
|---|
| Name | BDBM171374 |
|---|
| Synonyms: | US9085571, Table 1, Compound 22 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H46N4O8S |
|---|
| Mol. Mass. | 706.848 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)c1cc(OC)cc(c1)C(=O)N(C)Cc1nc(C)oc1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
