| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM172716 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 2.4±n/a nM |
|---|
| Citation |  Gregory, MA; Moss, SJ; Wilkinson, B Compound and methods for its production US Patent US9090657 Publication Date 7/28/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM172716 |
|---|
| n/a |
|---|
| Name | BDBM172716 |
|---|
| Synonyms: | US9090657, Sanglifehrin A, 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C60H91N5O13 |
|---|
| Mol. Mass. | 1090.3902 |
|---|
| SMILES | CC[C@H]1C[C@H](C)[C@@]2(NC1=O)O[C@@H](C[C@H](O)[C@@H](C)CC\C=C\C=C(/C)[C@@H]1C\C=C\C=C\[C@H](O)[C@H](C)[C@@H](O)[C@@H](CCC(C)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc3cccc(O)c3)C(=O)N3CCCC(N3)C(=O)O1)[C@H](C)[C@H](O)[C@@H]2C |r,t:27,29| |
|---|
| Structure | 
|
|---|
Search and Browse
