| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM176677 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Quenching Assay |
|---|
| Kd | 4200±300 nM |
|---|
| Citation |  Shapiro, PS; MacKerell, Jr., AD; Fletcher, S Non-ATP dependent inhibitors of extracellular signal-regulated kinase (ERK) US Patent US9115122 Publication Date 8/25/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | Crk1 | Csbp1 | Csbp2 | MAP Kinase p38 alpha | MAP kinase p38 | MK14_MOUSE | Mapk14 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41281.22 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography. |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM176677 |
|---|
| n/a |
|---|
| Name | BDBM176677 |
|---|
| Synonyms: | US9115122, SF-2-062 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22N2O4S2 |
|---|
| Mol. Mass. | 442.551 |
|---|
| SMILES | CCOc1ccc(\C=C2/SC(=S)N(CCNCc3ccc(cc3)C(O)=O)C2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
