Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM179577 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Surface plasmon resonance (SPR) |
---|
IC50 | 1980.97±n/a nM |
---|
Citation | Visser, MS; Yusuff, N Compounds for inhibiting the interaction of BCL2 with binding partners US Patent US9126980 Publication Date 9/8/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM179577 |
---|
n/a |
---|
Name | BDBM179577 |
Synonyms: | US9126980, 22 |
Type | Small organic molecule |
Emp. Form. | C37H43Cl2N5O4S |
Mol. Mass. | 724.739 |
SMILES | CCCCN(CCCC)C(=O)c1cc(C)n(n1)-c1ccc(NS(=O)Cc2ccc(Cl)c(Cl)c2)cc1C(=O)N1Cc2ccccc2C[C@H]1CO |r| |
Structure |
|